PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G000600.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family WOX
Protein Properties Length: 345aa    MW: 38895.3 Da    PI: 8.6248
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G000600.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox70.12.6e-2288147357
                        --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
           Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                        +R+++t+eql++Leel+++ +r+psae++++++++l    +++ ++V++WFqN++a+e++
  Aqcoe3G000600.2.p  88 TRWNPTPEQLQTLEELYRRgTRTPSAEQIQQITAQLrrfgKIEGKNVFYWFQNHKARERQ 147
                        8*****************99**************************************97 PP

2Wus_type_Homeobox115.52.5e-3787149365
  Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        +tRW+PtpeQ++ Leely++G+rtP++e+iq+ita+L+++Gkie+kNVfyWFQN+kaRerqk+
  Aqcoe3G000600.2.p  87 STRWNPTPEQLQTLEELYRRGTRTPSAEQIQQITAQLRRFGKIEGKNVFYWFQNHKARERQKR 149
                        79***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003892.1E-485152IPR001356Homeobox domain
SuperFamilySSF466892.78E-1288151IPR009057Homeodomain-like
PfamPF000465.4E-2088147IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.7E-988147IPR009057Homeodomain-like
CDDcd000861.53E-588143No hitNo description
PROSITE profilePS5007111.48393148IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048513Biological Processanimal organ development
GO:0099402Biological Processplant organ development
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MWMMGCSDVS DSLKGSRKLA PVLPRTSTIT STTTTSTNNN SYGGATATHP YLGRLHGNDH  60
LLVLNHHLAV SEQSKRDFSA APTTLVSTRW NPTPEQLQTL EELYRRGTRT PSAEQIQQIT  120
AQLRRFGKIE GKNVFYWFQN HKARERQKRR RRSKSAEEEH QQGSVESIEN KESGSSRTNF  180
EVHEQQAKHW GFTTNFSTVT QDSVSMQRAE RAAEISERIQ FEEAQQVQQR RLVDRHAMWQ  240
MMQLSCSSPT TTPMYTTTST TTSAAVLGTL MNPAIINNQY LNISKEPQSE NVDKHEESHT  300
LQLFPARNSG VESGPNVAVQ KASELACIET VNTNCSPKQF FEFL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014514810.12e-94PREDICTED: WUSCHEL-related homeobox 1-like
TrEMBLA0A0S3QWC72e-94A0A0S3QWC7_PHAAN; Uncharacterized protein
STRINGGLYMA05G33850.28e-90(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18010.13e-36WUSCHEL related homeobox 1